PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01992.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 373aa    MW: 41324.2 Da    PI: 6.2343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01992.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd +lv++++++G+g+W+  ++  g+ R++k+c++rw +yl
  mrna01992.1-v1.0-hybrid 14 KGPWTSEEDVILVNYIQEHGSGNWRNLPKNAGLQRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding54.42.8e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  mrna01992.1-v1.0-hybrid  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.32961IPR017930Myb domain
SuperFamilySSF466891.72E-3011108IPR009057Homeodomain-like
SMARTSM007175.2E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001672.62E-111661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.47E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTSE EDVILVNYIQ EHGSGNWRNL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLSSILG SYVSNINPAA ALLNLSNLLG TQQALNVNPE LLRLVTTLSS  180
LKQGNPQMFS QNQNPVCNIS HDLQNQLVPS LQSNHQLQNL FQDDFSPDIA NLKQLMQMIN  240
TEGNLPNMSN FSSPASYSPE TIVPNSNIGP ETAASKLPCY VPSSTSNPTA PELAGHSFFQ  300
SPLNNSNVNH DFGFDSVLST PHSSSPTPLN SSGTYTNINS SSTEDERDLE SYCSNLLKFE  360
IPDSTLDIND YI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293469.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLQ2LME61e-153Q2LME6_MALDO; MYB domain class transcription factor
STRINGPOPTR_0019s14070.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-98MYB-like 102